Skip to content
  • Home
  • Games
  • Nintendo
  • Steam
  • Video Reviews
  • Xbox
  • Contact Us

GameBottle+

Video Games Reviews | Gaming News | Addicting Games

  • Home
  • Games
  • Nintendo
  • Steam
  • Video Reviews
  • Xbox
  • Contact Us

Flash News

Ragnarocks Gameplay & Review - A Viking Settlement Abstract Game

Ragnarocks Gameplay & Assessment – A Viking Settlement Summary Sport

Bloodborne: The Board Game Large Expansion Review   with Tom Vasel

Bloodborne: The Board Recreation Giant Enlargement Evaluation with Tom Vasel

Ex-Activision Pioneers Form Audacity Games, Will Develop New Atari 2600 Titles

Ex-Activision Pioneers Kind Audacity Video games, Will Develop New Atari 2600 Titles

Official Teaser: Disney's Maleficent: Mistress of Evil - In Theaters October 18!

Official Teaser: Disney's Maleficent: Mistress of Evil – In Theaters October 18!

Assassin's Creed Syndicate Has The Best Ending Of The Series

Murderer’s Creed Syndicate Has The Finest Ending Of The Sequence

Board Game Reviews Ep #76: ASCENSION: DELIRIUM

Board Sport Opinions Ep #76: ASCENSION: DELIRIUM

Tomb Raider: Definitive Survivor Trilogy Spotted For Xbox

Tomb Raider: Definitive Survivor Trilogy Noticed For Xbox

Blizzard Arcade Collection Review (Switch eShop)

Blizzard Arcade Assortment Overview (Swap eShop)

TimeBomb review - Board Game Brawl

TimeBomb evaluation – Board Recreation Brawl

Russian, Chinese hackers may have stolen European vaccine data

Russian, Chinese language hackers could have stolen European vaccine knowledge

Sunday, March 07, 2021

Tag: Christian

Catechumen – PC Sport Evaluation – brutalmoose
Video Reviews

Catechumen – PC Sport Evaluation – brutalmoose

admin October 26, 2020

Ian explores the smelly Catacombs of Rome in Catechumen. ♥ It’s best to subscribe! » ♥ Turn into a Patron » If you happen to loved this retro assessment of … Read More

90sBible GamebrutalmooseCatechumenChristianClassiccommentarycomputerdiscussiondosfootagefpsfunnygamegame playgame reviewgameplaygamesgaminghidden blockhiddenblocklazy game reviewslet's playlgrmicrosoft windows (operating system)MS-DOSOriginaloverviewpcphreakindeeplayplaythroughretroreviewReviewssoftwarevideoVideo gamevideo game (industry)Video GamesvintagewalkthroughweirdWindowswindows 3.1windows 95windows 98 23 Comments on Catechumen – PC Sport Evaluation – brutalmoose

Categories

  • Games
  • Nintendo
  • Steam
  • Video Reviews
  • Xbox

Recent Comments

  • Lio Lio on Ragnarocks Gameplay & Assessment – A Viking Settlement Summary Sport
  • Artem Stepin on Ragnarocks Gameplay & Assessment – A Viking Settlement Summary Sport
  • sweekun on Ragnarocks Gameplay & Assessment – A Viking Settlement Summary Sport
  • Jake Sanders on Ragnarocks Gameplay & Assessment – A Viking Settlement Summary Sport
  • robbe hendrickx on Ragnarocks Gameplay & Assessment – A Viking Settlement Summary Sport

Tags

Board game Board games comedy funny game gameplay game review games games reviews games reviews net gaming genesis HD IGN nes Nintendo official pc play PLAYSTATION PlayStation 4 ps2 ps3 PS4 retro review review game review games Reviews reviews games sega snes steam the game reviews Trailer tutorial tv video Video game video game review Video Games walkthrough wii xbox Xbox One

Archives

  • March 2021
  • February 2021
  • January 2021
  • December 2020
  • November 2020
  • October 2020
  • September 2020
  • August 2020
  • August 2016
Proudly powered by WordPress | Theme: TimesNews | By ThemeSpiral.com.
We use cookies on our website to give you the most relevant experience by remembering your preferences and repeat visits. By clicking “Accept”, you consent to the use of ALL the cookies.
Do not sell my personal information.
Cookie settingsACCEPT
Privacy & Cookies Policy

Privacy Overview

This website uses cookies to improve your experience while you navigate through the website. Out of these cookies, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may have an effect on your browsing experience.
Necessary
Always Enabled

Necessary cookies are absolutely essential for the website to function properly. This category only includes cookies that ensures basic functionalities and security features of the website. These cookies do not store any personal information.

Non-necessary

Any cookies that may not be particularly necessary for the website to function and is used specifically to collect user personal data via analytics, ads, other embedded contents are termed as non-necessary cookies. It is mandatory to procure user consent prior to running these cookies on your website.

SAVE & ACCEPT